Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB)

In Stock
Code CSB-EP357862SKY
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP357862SKY could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) hlgB.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP357862SKY could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) hlgB.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
hlgB
Uniprot No.
Research Area
others
Alternative Names
hlgB; SA2209; Gamma-hemolysin component B; H-gamma-1; H-gamma-I
Species
Staphylococcus aureus (strain N315)
Source
E.coli
Expression Region
26-325aa
Target Protein Sequence
AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
38.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Staphylococcus aureus (strain N315) hlgB contains amino acids 26-325. This hlgB protein is expected to have a theoretical molecular weight of 38.1 kDa. This hlgB protein is produced using e.coli expression system. The N-terminal 6xHis tag was smoothly integrated into the coding gene of hlgB, which enables a simple process of detecting and purifying the hlgB recombinant protein in the following steps.

The Staphylococcus aureus gamma-hemolysin component B (hlgB) is a subunit of the bicomponent gamma-hemolysin toxin, which also includes HlgA. Gamma-hemolysin is known for its hemolytic activity, which involves the lysis of red blood cells. The hlgB in conjunction with HlgA, forms pores in the target cell membrane, leading to cell lysis. This cytolytic activity is implicated in the pathogenicity of S. aureus, contributing to tissue damage and evasion of the host immune response. Understanding the molecular mechanisms and regulation of gamma-hemolysin, including the role of HlgB, is crucial for developing strategies to combat S. aureus infections. Additionally, the study of this toxin provides insights into the intricate interactions between bacterial pathogens and host cells.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity.
Protein Families
Aerolysin family
Database Links

KEGG: sau:SA2209

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*